PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G18630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 411aa    MW: 46035.3 Da    PI: 7.1082
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G18630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.1e-344498155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  OPUNC05G18630.1 44 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 98
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.38741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-324299IPR009057Homeodomain-like
SuperFamilySSF466898.6E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-234499IPR006447Myb domain, plants
PfamPF002497.7E-104697IPR001005SANT/Myb domain
PfamPF143792.8E-22145192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MYHQHQGRSD LFTTRTSFPM ERHLFLHGGN TQGDSGLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGAEKA TPKTVMRLMG IPGLTLYHLK SHLQKYRLSK NLQGQANVGT TKNALGCTAV  120
VDRIPGTSAL AMASANAIPQ AEKTIQIGEA LQMQIEVQRQ LNEQLEVQRH LQLRIEAQGK  180
YLQAVLEQAQ ETLGKQNLGP ASLEDAKIKI SELVSQVSNE CLSNAVTEIR ESSSIHRLEP  240
RQIQFVESSA NNSLTAAEGF KEHRLQNHGV LKAYDDSTLF CRKQSQDQES QYSLNRSLSE  300
RRMGHLYNGK QYHKAEGSDS DTEVLHEYIT PQKNGGGSTT SSTSGSKEIN VEKLYLDEPS  360
CKRQAVDYQR ESKLLDFDQQ SSGKNLDLNT HNIDDNDQGY RHFDLNGFSW S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413620.0AK241362.1 Oryza sativa Japonica Group cDNA, clone: J065151H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640413.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
RefseqXP_015640414.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
RefseqXP_015640415.10.0PREDICTED: uncharacterized protein LOC4339151 isoform X1
TrEMBLA0A0E0L4220.0A0A0E0L422_ORYPU; Uncharacterized protein
STRINGLOC_Os05g40960.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122793137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.37e-98G2-like family protein